T3DB Logo

Showing toxin card for Di(2-ethylhexyl)phthalate (T3D0076)

Legend: toxin field target field

Version 1.0
Creation Date 2009-03-06 18:58:02
Update Date 2010-05-18 20:48:41
Accession Number T3D0076
Name Di(2-ethylhexyl)phthalate
Compound Type
  • Aromatic Hydrocarbon
  • Cosmetic Toxin
  • Organic Compound
  • Phthalate
  • Plasticizer
Description Di(2-ethylhexyl) phthlate (DEHP) is a manufactured chemical that is commonly added to plastics to make them flexible. DEHP exposure is generally low and not harmful, but increased exposures resulting from intravenous fluids delivered through plastic tubing or ingesting contaminated foods or water may have toxic effects. This is of particular concern since DEHP is known to leach into liquid that come in contact with DEHP containing plastic. (R355, R356)
Synonyms
  1. Dioctyl phthalate
  2. 1, 2-Benzenedicarboxylic Acid, bis(2-ethylhexyl) ester
  3. 1, 2-Benzenedicarboxylic Acid, bis(ethylhexyl) ester
  4. 1,2-Benzenedicarboxylic Acid
  5. 1,2-Benzenedicarboxylic Acid bis(2-ethylhexyl) ester
  6. 1,2-Benzenedicarboxylic Acid bis-(1-ethylhexyl) ester
  7. 1,2-Benzenedicarboxylic Acid, bis(2-ethylhexyl) ester
  8. 1,2-Benzenedicarboxylic Acid, bis(ethylhexyl) ester
  9. 1,2-Benzenedicarboxylic Acid, bis-(1-ethylhexyl) ester
  10. 2-Ethylhexyl phthalate
  11. Benzenedicarboxylic Acid, bis(2-ethylhexyl) ester
  12. Bi(2-ethylhexyl)trimellitate ester
  13. Bis (2-Ethylhexyl) Phthalate (Dioctyl phthalate)
  14. Bis(2-ethylhexy) phthalate
  15. Bis(2-ethylhexyl) 1, 2-benzenedicarboxylate
  16. Bis(2-ethylhexyl) 1,2-benzenedicarboxylate
  17. Bis(2-ethylhexyl) o-phthalate
  18. Bis(2-ethylhexyl) phthalate
  19. Bis(2-ethylhexyl) phthalate-ring-UL-14C
  20. Bis(2-ethylhexyl)ester phthalic Acid
  21. Bis(ethylhexyl) phthalate
  22. Bis-(2-ethylhexyl)-phthalate (DEHP)
  23. Bis-(2-ethylhexyl)ester kyseliny ftalove [Czech]
  24. Bis-2-ethyl-hexyl-phthalate
  25. Di(2-Ethylhexyl phthalate)
  26. Di(2-ethylhexyl) o-phthalate
  27. Di(2-ethylhexyl) orthophthalate
  28. Di(2-ethylhexyl) phthalate
  29. Di(2-ethylhexyl)orthophthalate
  30. Di(2-ethylhexyl)phthalate
  31. Di(ethylhexyl) phthalate
  32. Di-(2-ethylhexyl) phthalate
  33. Di-2 ethyl hexyl adipate
  34. Di-2-ethyl hexyl azelate
  35. Di-2-ethylhexyl phthalate
  36. Di-2-ethylhexylphthalate
  37. Di-iso-octyl phthalate
  38. Di-sec-octyl phthalate
  39. Diacizer dop
  40. Dicapryl phthalate
  41. Diethylhexyl phthalate
  42. Dioctyl o-benzenedicarboxylate
  43. Dioctyl phthalate
  44. Dioctyl phthalate (van)
  45. Dioctyl-o-benzenedicarboxylate
  46. Dioctylphthalate
  47. Dof [russian plasticizer]
  48. Ergoplas t fdo
  49. Ergoplast fdo
  50. Ergoplast fdo-s
  51. Etalon
  52. Etalon (plasticizer)
  53. Ethyl hexyl phthalate
  54. Ethylhexyl phthalate
  55. Fleximel
  56. Flexol dop
  57. Flexol plasticizer dop
  58. Good-rite gp 264
  59. Hatcol dop
  60. Hercoflex 260
  61. Jayflex dop
  62. Kodaflex DP
  63. Kodaflex dehp
  64. Kodaflex dop
  65. Merrol dop
  66. Mollan o
  67. Monocizer dop
  68. Morflex 310
  69. Morflex 410
  70. N-dioctyl phthalate
  71. Nuoplaz dop
  72. O-benzenedicarboxylic Acid, dioctyl ester
  73. Octoil
  74. Octyl PH thalate
  75. Octyl phthalate
  76. Octyl phthalate (van)
  77. Palatinol ah
  78. Palatinol dop
  79. Phthalic Acid bis(2-ethylhexyl ester)
  80. Phthalic Acid bis(2-ethylhexyl ester)-ring-UL-14C
  81. Phthalic Acid di(2-ethylhexyl) ester
  82. Phthalic Acid dioctyl ester
  83. Phthalic Acid dioctyl ester (van)
  84. Phthalic Acid, bis(2-ethylhexyl) ester
  85. Phthalic Acid, dioctyl ester
  86. Pittsburgh PX-138
  87. Plasthall dop
  88. Plasticizer 28P
  89. Platinol ah
  90. Platinol dop
  91. Polycizer 162
  92. Polycizer dop
  93. RC plasticizer dop
  94. Reomol D 79P
  95. Reomol DCP
  96. Reomol dop
  97. Sansocizer R 8000
  98. Sansocizer dop
  99. Sconamoll dop
  100. Sicol 150
  101. Staflex dop
  102. Truflex dop
  103. Union carbide flexo l 380
  104. Union carbide flexol 380
  105. Vestinol ah
  106. Vinicizer 80
  107. Witcizer 312
  108. Bis (2-Etheylexyl) Phthalate
  109. Bis-(2-ethylhexyl) 1,2-benzenedicar boxylate
  110. Bis-(2-ethylhexyl) 1,2-benzenedicarboxylate
Chemical IUPAC Name 1,2-bis(2-ethylhexyl) benzene-1,2-dicarboxylate
Chemical Formula C24H38O4
Chemical Structure Structure
CAS Registry Number 117-81-7
InChI Identifier InChI=1S/C24H38O4/c1-5-9-13-19(7-3)17-27-23(25)21-15-11-12-16-22(21)24(26)28-18-20(8-4)14-10-6-2/h11-12,15-16,19-20H,5-10,13-14,17-18H2,1-4H3
InChI Key InChIKey=BJQHLKABXJIVAM-UHFFFAOYSA-N
PubChem Compound ID 8343 Link Image
KEGG ID C03690 Link Image
UniProt ID Not Available
OMIM ID Not Available
ChEBI ID 17747 Link Image
BioCyc ID BIS2-ETHYLHEXYLPHTHALATE Link Image
SuperToxic ID Not Available
CTD ID D004051 Link Image
Stitch ID Di(2-ethylhexyl)phthalate Link Image
DrugBank ID Not Available
PDB ID Not Available
ACToR ID 617
Wikipedia Link http://en.wikipedia.org/wiki/Bis(2-ethylhexyl)phthalate Link Image
Monoisotopic Mass 390.27701
MOL File Show
PDB File Show
SDF File Show
SMILES CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC
Appearance Coloress liquid.
Melting Point -55 °C
Solubility 0.00027 mg/mL at 25 °C [DEFOE,DL et al. (1990)]
Predicted LogP 8.0254
Route of Exposure Oral (W647) ; inhalation (W647) ; dermal (W647)
Mechanism of Action Monoethylhexylphthalate (MEHP), one of the major metabolites of DEHP, induces peroxisome proliferation by activating peroxisome proliferator activated receptors. This is believed to increase production of hydrogen peroxide by peroxisomes and enhance cell proliferation, leading to hepatotoxic and carcinogenic effects. MEHP is also believed to exhibit testicular toxicity by targeting and damaging the Sertoli cells. DEHP may act as an antiandrogen during a critical stage of reproductive tract differentiation by reducing testosterone in fetal males, hindering development. (R355, R262)
Metabolism DEHP is mainly absorbed via ingestion. It is hydrolyzed in the small intestine and absorbed as monoethylhexylphthalate (MEHP) and 2-ethylhexanol, then likely distributed to the adipose tissues and kidneys. MEHP is further metabolized via numerous oxidative reactions, resulting in the formation of 30 or more metabolites, some of which can be conjugated with glucuronic acid for excretion. Oxidation of 2-ethylhexanol primarily yields 2-ethylhexanoic acid and several keto acid derivatives. Most DEHP metabolites are excreted in the urine as glucuronide conjugates, while unmetabolized DEHP is excreted in the faeces. (R355)
Toxicity Values LD50: 33.9 g/kg (Oral, Rabbit) (R360) LD50: 10 g/kg (Dermal, Guinea pig) (R360) LD50: 30.7 g/kg (Intraperitoneal, Rat) (R360)
Lethal Dose Not Available
Carcinogenicity (IARC Classification) 3, not classifiable as to its carcinogenicity to humans. (R264)
Uses/Sources DEHP is present in plastic products such as wall coverings, tablecloths, floor tiles, furniture upholstery, shower curtains, garden hoses, swimming pool liners, rainwear, baby pants, dolls, some toys, shoes, automobile upholstery and tops, packaging film and sheets, sheathing for wire and cable, medical tubing, and blood storage bags. (R355)
Minimum Risk Level Intermediate Oral: 0.1 mg/kg/day (R260) Chronic Oral: 0.06 mg/kg/day (R260)
Health Effects Chronic and/or high levels of DEHP exposure may cause reproductive and developmental damage. This includes damaged sperm, delayed sexual maturity, and deficiencies in the development of male babies. DEHP may also cause liver and kidney damage, and is potentially carcinogenic. (R355, R356)
Symptoms Phthalate esters are endocrine disruptors and can cause a number of developmental malformations termed 'phthalate syndrome'. (W642)
Treatment Not Available
General References
  • R360 - WHO (1992). Environmental Health Criteria 131: Diethylhexyl Phthalate.
  • R356 - Wikipedia. Bis(2-ethylhexyl) phthalate. Last Updated 25 April 2009.
  • R264 - International Agency for Research on Cancer (2009). IARC Monographs on the Evaluation of Carcinogenic Risks to Humans.
  • R260 - ATSDR - Agency for Toxic Substances and Disease Registry (2001). Minimal Risk Levels (MRLs) for Hazardous Substances. U.S. Public Health Service in collaboration with U.S. Environmental Protection Agency (EPA).
  • R355 - ATSDR - Agency for Toxic Substances and Disease Registry (2002). Toxicological profile for di(2-ethylhexyl)phthalate (DEHP). U.S. Public Health Service in collaboration with U.S. Environmental Protection Agency (EPA).
  • W647 - Wikipedia. Phthalate. Last Updated 22 November 2009. []
  • R262 - Lapinskas PJ, Brown S, Leesnitzer LM, Blanchard S, Swanson C, Cattley RC, Corton JC: Role of PPARalpha in mediating the effects of phthalates and metabolites in the liver. Toxicology. 2005 Feb 1;207(1):149-63. [PubMed Link Image]
Targets
  1. Peroxisome proliferator-activated receptor alpha
  2. Peroxisome proliferator-activated receptor delta
  3. Peroxisome proliferator-activated receptor gamma
Target 1 [top]
Target 1 ID 46
Target 1 Name Peroxisome proliferator-activated receptor alpha
Target 1 Mechanism of Action Monoethylhexylphthalate (MEHP), one of the major metabolites of DEHP, induces peroxisome proliferation by activating peroxisome proliferator activated receptors. This is believed to increase production of hydrogen peroxide by peroxisomes and enhance cell proliferation, leading to hepatotoxic and carcinogenic effects. (R359)
Target 1 Description Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl- 2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety (By similarity). Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene
Target 1 Synonyms
  1. PPAR-alpha; Nuclear receptor subfamily 1 group C member 1
Target 1 Gene Name PPARA
Target 1 Protein Sequence >Peroxisome proliferator-activated receptor alpha 
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Target 1 Number of Residues 468
Target 1 Molecular Weight 52224.6
Target 1 Theoretical pI 6.20
Target 1 GO Classification
Function
steroid hormone receptor activity
transcription factor activity
signal transducer activity
receptor activity
ligand-dependent nuclear receptor activity
binding
nucleic acid binding
DNA binding
Process
regulation of biological process
regulation of physiological process
regulation of metabolism
regulation of cellular metabolism
regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolism
regulation of transcription
regulation of transcription, DNA-dependent
Component
organelle
membrane-bound organelle
intracellular membrane-bound organelle
nucleus
Target 1 General Function Involved in drug binding
Target 1 Pathways Not Available
Target 1 Reactions Not Available
Target 1 Signals
  • None
Target 1 Transmembrane Regions
  • None
Target 1 Essentiality Non Essential
Target 1 Domain Function PF00104:Hormone_recep PF00105:zf-C4
Target 1 GenBank ID Protein Not Available
Target 1 UniProtKB ID Q07869 Link Image
Target 1 Cellular Location Nucleus
Target 1 Gene Sequence >1407 bp 
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAG
AGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGGAAACATCCAAGAGATTTCGCAATCC
ATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGACACGCTTTCACCAGCTTCGAGCCCCTCCTCG
GTGACTTATCCTGTGGTCCCCGGCAGCGTGGACGAGTCTCCCAGTGGAGCATTGAACATC
GAATGTAGAATCTGCGGGGACAAGGCCTCAGGCTATCATTACGGAGTCCACGCGTGTGAA
GGCTGCAAGGGCTTCTTTCGGCGAACGATTCGACTCAAGCTGGTGTATGACAAGTGCGAC
CGCAGCTGCAAGATCCAGAAAAAGAACAGAAACAAATGCCAGTATTGTCGATTTCACAAG
TGCCTTTCTGTCGGGATGTCACACAACGCGATTCGTTTTGGACGAATGCCAAGATCTGAG
AAAGCAAAACTGAAAGCAGAAATTCTTACCTGTGAACATGACATAGAAGATTCTGAAACT
GCAGATCTCAAATCTCTGGCCAAGAGAATCTACGAGGCCTACTTGAAGAACTTCAACATG
AACAAGGTCAAAGCCCGGGTCATCCTCTCAGGAAAGGCCAGTAACAATCCACCTTTTGTC
ATACATGATATGGAGACACTGTGTATGGCTGAGAAGACGCTGGTGGCCAAGCTGGTGGCC
AATGGCATCCAGAACAAGGAGGTGGAGGTCCGCATCTTTCACTGCTGCCAGTGCACGTCA
GTGGAGACCGTCACGGAGCTCACGGAATTCGCCAAGGCCATCCCAGCGTTCGCAAACTTG
GACCTGAACGATCAAGTGACATTGCTAAAATACGGAGTTTATGAGGCCATATTCGCCATG
CTGTCTTCTGTGATGAACAAAGACGGGATGCTGGTAGCGTATGGAAATGGGTTTATAACT
CGTGAATTCCTAAAAAGCCTAAGGAAACCGTTCTGTGATATCATGGAACCCAAGTTTGAT
TTTGCCATGAAGTTCAATGCACTGGAACTGGATGACAGTGATATCTCCCTTTTTGTGGCT
GCTATCATTTGCTGTGGAGATCGTCCTGGCCTTCTAAACGTAGGACACATTGAAAAAATG
CAGGAGGGTATTGTACATGTGCTCAGACTCCACCTGCAGAGCAACCACCCGGACGATATC
TTTCTCTTCCCAAAACTTCTTCAAAAAATGGCAGACCTCCGGCAGCTGGTGACGGAGCAT
GCGCAGCTGGTGCAGATCATCAAGAAGACGGAGTCGGATGCTGCGCTGCACCCGCTACTG
CAGGAGATCTACAGGGACATGTACTGA
Target 1 GenBank Gene ID Not Available
Target 1 GeneCard ID PPARA Link Image
Target 1 GenAtlas ID PPARA Link Image
Target 1 HGNC ID HGNC:9232 Link Image
Target 1 Chromosome Location Chromosome:22
Target 1 Locus 22q12-q13.1|22q13.31
Target 1 SNPs SNPJam Report Link Image
Target 1 Toxin References
  • R262 - Lapinskas PJ, Brown S, Leesnitzer LM, Blanchard S, Swanson C, Cattley RC, Corton JC: Role of PPARalpha in mediating the effects of phthalates and metabolites in the liver. Toxicology. 2005 Feb 1;207(1):149-63. [PubMed Link Image]
Target 1 General References 7684926; 7981125; 8993548; 18619963; 19263263; 15461802; 14702039; 10591208
Target 2 [top]
Target 2 ID 533
Target 2 Name Peroxisome proliferator-activated receptor delta
Target 2 Mechanism of Action Monoethylhexylphthalate (MEHP), one of the major metabolites of DEHP, induces peroxisome proliferation by activating peroxisome proliferator activated receptors. This is believed to increase production of hydrogen peroxide by peroxisomes and enhance cell proliferation, leading to hepatotoxic and carcinogenic effects. (R359)
Target 2 Description Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand
Target 2 Synonyms
  1. PPAR-delta; PPAR-beta; Nuclear receptor subfamily 1 group C member 2; Nuclear hormone receptor 1; NUC1; NUCI
Target 2 Gene Name PPARD
Target 2 Protein Sequence >Peroxisome proliferator-activated receptor delta 
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Target 2 Number of Residues 441
Target 2 Molecular Weight 49903.0
Target 2 Theoretical pI 7.65
Target 2 GO Classification
Function
steroid hormone receptor activity
transcription factor activity
signal transducer activity
receptor activity
ligand-dependent nuclear receptor activity
binding
nucleic acid binding
DNA binding
Process
regulation of biological process
regulation of physiological process
regulation of metabolism
regulation of cellular metabolism
regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolism
regulation of transcription
regulation of transcription, DNA-dependent
Component
organelle
membrane-bound organelle
intracellular membrane-bound organelle
nucleus
Target 2 General Function Involved in drug binding
Target 2 Pathways Not Available
Target 2 Reactions Not Available
Target 2 Signals
  • None
Target 2 Transmembrane Regions
  • None
Target 2 Essentiality Non Essential
Target 2 Domain Function PF00104:Hormone_recep PF00105:zf-C4
Target 2 GenBank ID Protein Not Available
Target 2 UniProtKB ID Q03181 Link Image
Target 2 Cellular Location Nucleus
Target 2 Gene Sequence >1326 bp 
ATGGAGCAGCCACAGGAGGAAGCCCCTGAGGTCCGGGAAGAGGAGGAGAAAGAGGAAGTG
GCAGAGGCAGAAGGAGCCCCAGAGCTCAATGGGGGACCACAGCATGCACTTCCTTCCAGC
AGCTACACAGACCTCTCCCGGAGCTCCTCGCCACCCTCACTGCTGGACCAACTGCAGATG
GGCTGTGACGGGGCCTCATGCGGCAGCCTCAACATGGAGTGCCGGGTGTGCGGGGACAAG
GCATCGGGCTTCCACTACGGTGTTCATGCATGTGAGGGGTGCAAGGGCTTCTTCCGTCGT
ACGATCCGCATGAAGCTGGAGTACGAGAAGTGTGAGCGCAGCTGCAAGATTCAGAAGAAG
AACCGCAACAAGTGCCAGTACTGCCGCTTCCAGAAGTGCCTGGCACTGGGCATGTCACAC
AACGCTATCCGTTTTGGTCGGATGCCGGAGGCTGAGAAGAGGAAGCTGGTGGCAGGGCTG
ACTGCAAACGAGGGGAGCCAGTACAACCCACAGGTGGCCGACCTGAAGGCCTTCTCCAAG
CACATCTACAATGCCTACCTGAAAAACTTCAACATGACCAAAAAGAAGGCCCGCAGCATC
CTCACCGGCAAAGCCAGCCACACGGCGCCCTTTGTGATCCACGACATCGAGACATTGTGG
CAGGCAGAGAAGGGGCTGGTGTGGAAGCAGTTGGTGAATGGCCTGCCTCCCTACAAGGAG
ATCAGCGTGCACGTCTTCTACCGCTGCCAGTGCACCACAGTGGAGACCGTGCGGGAGCTC
ACTGAGTTCGCCAAGAGCATCCCCAGCTTCAGCAGCCTCTTCCTCAACGACCAGGTTACC
CTTCTCAAGTATGGCGTGCACGAGGCCATCTTCGCCATGCTGGCCTCTATCGTCAACAAG
GACGGGCTGCTGGTAGCCAACGGCAGTGGCTTTGTCACCCGTGAGTTCCTGCGCAGCCTC
CGCAAACCCTTCAGTGATATCATTGAGCCTAAGTTTGAATTTGCTGTCAAGTTCAACGCC
CTGGAACTTGATGACAGTGACCTGGCCCTATTCATTGCGGCCATCATTCTGTGTGGAGAC
CGGCCAGGCCTCATGAACGTTCCACGGGTGGAGGCTATCCAGGACACCATCCTGCGTGCC
CTCGAATTCCACCTGCAGGCCAACCACCCTGATGCCCAGTACCTCTTCCCCAAGCTGCTG
CAGAAGATGGCTGACCTGCGGCAACTGGTCACCGAGCACGCCCAGATGATGCAGCGGATC
AAGAAGACCGAAACCGAGACCTCGCTGCACCCTCTGCTCCAGGAGATCTACAAGGACATG
TACTAA
Target 2 GenBank Gene ID Not Available
Target 2 GeneCard ID PPARD Link Image
Target 2 GenAtlas ID PPARD Link Image
Target 2 HGNC ID HGNC:9235 Link Image
Target 2 Chromosome Location Not Available
Target 2 Locus 6p21.2-p21.1
Target 2 SNPs SNPJam Report Link Image
Target 2 Toxin References
  • R262 - Lapinskas PJ, Brown S, Leesnitzer LM, Blanchard S, Swanson C, Cattley RC, Corton JC: Role of PPARalpha in mediating the effects of phthalates and metabolites in the liver. Toxicology. 2005 Feb 1;207(1):149-63. [PubMed Link Image]
Target 2 General References 1333051; 10851270; 18619963; 14702039; 14574404; 15489334
Target 3 [top]
Target 3 ID 532
Target 3 Name Peroxisome proliferator-activated receptor gamma
Target 3 Mechanism of Action Monoethylhexylphthalate (MEHP), one of the major metabolites of DEHP, induces peroxisome proliferation by activating peroxisome proliferator activated receptors. This is believed to increase production of hydrogen peroxide by peroxisomes and enhance cell proliferation, leading to hepatotoxic and carcinogenic effects. (R359)
Target 3 Description Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis
Target 3 Synonyms
  1. PPAR-gamma; Nuclear receptor subfamily 1 group C member 3
Target 3 Gene Name PPARG
Target 3 Protein Sequence >Peroxisome proliferator-activated receptor gamma 
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Target 3 Number of Residues 505
Target 3 Molecular Weight 57619.6
Target 3 Theoretical pI 5.77
Target 3 GO Classification
Function
steroid hormone receptor activity
transcription factor activity
signal transducer activity
receptor activity
ligand-dependent nuclear receptor activity
binding
nucleic acid binding
DNA binding
Process
regulation of biological process
regulation of physiological process
regulation of metabolism
regulation of cellular metabolism
regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolism
regulation of transcription
regulation of transcription, DNA-dependent
Component
organelle
membrane-bound organelle
intracellular membrane-bound organelle
nucleus
Target 3 General Function Involved in arachidonic acid binding
Target 3 Pathways Not Available
Target 3 Reactions Not Available
Target 3 Signals
  • None
Target 3 Transmembrane Regions
  • None
Target 3 Essentiality Non Essential
Target 3 Domain Function PF00104:Hormone_recep PF00105:zf-C4
Target 3 GenBank ID Protein Not Available
Target 3 UniProtKB ID P37231 Link Image
Target 3 Cellular Location Nucleus
Target 3 Gene Sequence Not Available
Target 3 GenBank Gene ID Not Available
Target 3 GeneCard ID PPARG Link Image
Target 3 GenAtlas ID PPARG Link Image
Target 3 HGNC ID HGNC:9236 Link Image
Target 3 Chromosome Location Not Available
Target 3 Locus 3p25
Target 3 SNPs SNPJam Report Link Image
Target 3 Toxin References
  • R262 - Lapinskas PJ, Brown S, Leesnitzer LM, Blanchard S, Swanson C, Cattley RC, Corton JC: Role of PPARalpha in mediating the effects of phthalates and metabolites in the liver. Toxicology. 2005 Feb 1;207(1):149-63. [PubMed Link Image]
Target 3 General References 9065481; 8702406; 9144532; 7787419; 9356045; 8706692; 14702039

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government.