NameHLA class II histocompatibility antigen, DP beta 1 chain
Synonyms
  • HLA class II histocompatibility antigen, DP(W4) beta chain
  • HLA-DP1B
  • MHC class II antigen DPB1
Gene NameHLA-DPB1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008836|HLA class II histocompatibility antigen, DP beta 1 chain
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN
REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Number of residues258
Molecular Weight29159.195
Theoretical pINot Available
GO Classification
Functions
  • peptide antigen binding
Processes
  • positive regulation of T cell activation
  • antigen processing and presentation of exogenous peptide antigen via MHC class II
  • cytokine-mediated signaling pathway
  • positive regulation of T cell proliferation
  • positive regulation of interferon-gamma production
  • T cell costimulation
  • T cell receptor signaling pathway
  • interferon-gamma-mediated signaling pathway
Components
  • endosome membrane
  • transport vesicle membrane
  • ER to Golgi transport vesicle membrane
  • membrane
  • plasma membrane
  • clathrin-coated endocytic vesicle membrane
  • cell surface
  • integral component of lumenal side of endoplasmic reticulum membrane
  • Golgi membrane
  • MHC class II protein complex
  • trans-Golgi network membrane
  • endocytic vesicle membrane
  • lysosomal membrane
General FunctionPeptide antigen binding
Specific FunctionBinds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Pfam Domain Function
Transmembrane Regions226-246
GenBank Protein IDNot Available
UniProtKB IDP04440
UniProtKB Entry NameDPB1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0017609|HLA class II histocompatibility antigen, DP beta 1 chain (HLA-DPB1)
ATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGACAGTGGCTCTGACGGCGTTACTGATG
GTGCTGCTCACATCTGTGGTCCAGGGCAGGGCCACTCCAGAGAATTACCTTTTCCAGGGA
CGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTG
GGGCGGCCTGCTGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCA
GTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGC
CGAGTCCAGCCTAGGGTGAATGTTTCCCCCTCCAAGAAGGGGCCCTTGCAGCACCACAAC
CTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTG
AATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGG
ACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGC
CAAGTGGAGCACACCAGCCTGGATAGTCCTGTCACCGTGGAGTGGAAGGCACAGTCTGAT
TCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTCATCATCTGT
GGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGTTCAACGAGGATCTGCATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:4940
Chromosome Location6
LocusNot Available
References
  1. Kappes DJ, Arnot D, Okada K, Strominger JL: Structure and polymorphism of the HLA class II SB light chain genes. EMBO J. 1984 Dec 1;3(12):2985-93. 6098459
  2. Tonnelle C, DeMars R, Long EO: DO beta: a new beta chain gene in HLA-D with a distinct regulation of expression. EMBO J. 1985 Nov;4(11):2839-47. 2998758
  3. Kelly A, Trowsdale J: Complete nucleotide sequence of a functional HLA-DP beta gene and the region between the DP beta 1 and DP alpha 1 genes: comparison of the 5' ends of HLA class II genes. Nucleic Acids Res. 1985 Mar 11;13(5):1607-21. 2987832
  4. Gustafsson K, Widmark E, Jonsson AK, Servenius B, Sachs DH, Larhammar D, Rask L, Peterson PA: Class II genes of the human major histocompatibility complex. Evolution of the DP region as deduced from nucleotide sequences of the four genes. J Biol Chem. 1987 Jun 25;262(18):8778-86. 3036829
  5. Compagnone-Post P, Turco E, Robinson C, Trucco M: The beta-chains of DP4 molecules from different haplotypes are encoded by the same gene. Genomics. 1988 Jan;2(1):8-13. 2838415
  6. Korioth F, Hartung K, Deicher H, Frey J: A new HLA-DPB1 allele from a patient with systemic lupus erythematosus. Tissue Antigens. 1992 Apr;39(4):216-9. 1529429
  7. Reinders J, Rozemuller EH, van Gent R, Arts-Hilkes YH, van den Tweel JG, Tilanus MG: Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing. Immunogenetics. 2005 Nov;57(10):790-4. Epub 2005 Nov 8. 16189666
  8. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  9. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  11. Lee JS, Sartoris S, Briata P, Choi E, Cullen C, Lepaslier D, Yunis I: Sequence polymorphism of HLA-DP beta chains. Immunogenetics. 1989;29(5):346-9. 2714855
  12. Rani R, Fernandez-Vina MA, Zhang S, Stastny P: HLA-DPB1 alleles in a population from north India and description of a new variant (DPB1*5601). Tissue Antigens. 1995 Apr;45(4):264-9. 7638863
  13. Hessner MJ, Baxter-Lowe LA: Characterization of novel HLA-DPB1 alleles by oligotyping and nucleotide sequencing. Tissue Antigens. 1992 Nov;40(5):261-3. 1481203
  14. Meyer CG, May J, Simon C, Bohm BO, Loeliger CC: DPB1*TF, a novel HLA class II DPB1 allele (DPB1*6701) identified in a Turkish family. Tissue Antigens. 1996 Sep;48(3):231-2. 8896187
  15. Voorter C, Richeldi L, Gervais T, van den Berg-Loonen E: Identification of two new DPB1 alleles, DPB1*7701 and *7801, by sequence-based typing. Tissue Antigens. 1998 Aug;52(2):190-2. 9756410
  16. Voorter C, Chatelain B, Sintnicolaas K, Tilanus M, Hidajat M, van den Berg-Loonen E: Identification of a new DPB1 allele (DPB1*7901) by sequence-based typing. Tissue Antigens. 1998 Aug;52(2):193-5. 9756411
  17. Weston A, Ensey JS, Frye BL: DNA-sequence determination of exon 2 of a novel HLA-DPB1 allele, HLA-DPB1*0403. DNA Seq. 2005 Jun;16(3):235-6. 16147881
  18. Moonsamy PV, Suraj VC, Bugawan TL, Saiki RK, Stoneking M, Roudier J, Magzoub MM, Hill AV, Begovich AB: Genetic diversity within the HLA class II region: ten new DPB1 alleles and their population distribution. Tissue Antigens. 1992 Sep;40(3):153-7. 1440570
  19. Versluis LF, Daly LN, Degli-Eposti MA, van der Zwan AW, Dawkins RL, Tilanus MG: Identification of the novel HLA-DPB1*5801 allele detected by sequenced based typing. Immunogenetics. 1995;41(2-3):173. 7806296
  20. Zimmerman PA, Steiner LL, Titanji VP, Nde PN, Bradley JE, Pogonka T, Begovich AB: Three new DPB1 alleles identified in a Bantu-speaking population from central Cameroon. Tissue Antigens. 1996 Apr;47(4):293-9. 8773318
  21. Gorski J, Rollini P, Long E, Mach B: Molecular organization of the HLA-SB region of the human major histocompatibility complex and evidence for two SB beta-chain genes. Proc Natl Acad Sci U S A. 1984 Jul;81(13):3934-8. 6330724
  22. Witter K, Kirchner E, Borelli C, Messer G, Albert T, Zahn R, Kauke T: In a study for acne vulgaris, sequence-based HLA typing showed a novel DPB1 allele, DPB1*2402. Tissue Antigens. 2009 Oct;74(4):354-6. doi: 10.1111/j.1399-0039.2009.01325.x. 19775376
  23. Bugawan TL, Horn GT, Long CM, Mickelson E, Hansen JA, Ferrara GB, Angelini G, Erlich HA: Analysis of HLA-DP allelic sequence polymorphism using the in vitro enzymatic DNA amplification of DP-alpha and DP-beta loci. J Immunol. 1988 Dec 1;141(11):4024-30. 2460556
  24. Bugawan TL, Begovich AB, Erlich HA: Rapid HLA-DPB typing using enzymatically amplified DNA and nonradioactive sequence-specific oligonucleotide probes. Immunogenetics. 1990;32(4):231-41. 2242906
  25. Buyse I, Emonds MP, Bouillon R, Marynen P, Cassiman JJ: Novel class II HLA-DRB4 and DPB1 alleles found in the Belgian population. Immunogenetics. 1993;38(5):380. 8344726
  26. Mizuki N, Ohno S, Sugimura K, Seki T, Mizuki N, Geng L, Ishioka M, Inoko H: Identification of a new HLA-DPB1 allele detected by PCR-RFLP and its nucleotide sequence determination by direct sequencing after PCR amplification. Tissue Antigens. 1993 May;41(5):259-62. 7901923
  27. Koshizaka T, Taguchi M, Onishi H, Kobayashi S, Inoko H: A new HLA-DPB1 allele, DPB1*SUT (DPB1*4701). Tissue Antigens. 1994 Jan;43(1):50-3. 7912859
  28. Kaneshige T, Kinoshita T, Hashimoto M, Matsumoto Y, Moribe T, Ichikawa Y, Fukunishi T, Uchida K: Direct sequencing of a novel DPB1 allele (DPB1*5101) of the heterozygote from the membrane of reverse dot blot analysis. Tissue Antigens. 1994 Sep;44(3):204-7. 7839356
  29. Schnittger L, May J, Kretschmer C, Kremsner PG, Meyer CG: DPB1*BR: an Mhc class II DPB1 allele (DPB1*6601) of negroid origin. Immunogenetics. 1996;44(5):405-6. 8781129
  30. Versluis LF, Philippe M, Van der Zwan A, Thonnard J, Tongio MM, Tilanus MG: Identification of a new HLA-DPB1*6501 allele in a Caucasian individual. Immunogenetics. 1996;44(6):483-4. 8824162
  31. Voorter CE, Tilanus MG, van den Berg-Loonen EM: Two new HLA DPB1 alleles identified by sequence-based typing: DPB1*8201 and DPB1*8301. Tissue Antigens. 2000 Dec;56(6):560-2. 11169249
  32. Bengtsson M: DPB1*8601, a previously unrecognized DPB1 variant in the Caucasoid population. Tissue Antigens. 2001 Jun;57(6):536-9. 11556983
  33. Grams SE, Wu J, Noreen HJ, Mangaccat J, Cognato MA, Johnson S, Segall M, Williams TM, Begovich AB: Three new DP alleles identified in a study of 800 unrelated bone marrow donor-recipient pairs. Tissue Antigens. 2001 Oct;58(4):272-5. 11782281
  34. Bengtsson M, Danielsson F, Jansson IE, Johansson U: Identification of a new HLA-DPB1 allele,HLA-DPB1*9001. Tissue Antigens. 2002 Apr;59(4):344-6. 12135440
  35. Liu ZH, Fan X, Lin J, Fu Y, Liu X, Xu A: Identification of a novel DPB1 allele, DPB1*9301, by sequence-based typing in a Lahu ethnic minority of China. Tissue Antigens. 2003 Mar;61(3):261-2. 12694578
  36. Luo M, Ramdahin S, Iqbal S, Pan Y, Jacobson K, Narayansingh MJ, Schroeder M, Brunham RC, Embree J, Plummer FA: High resolution sequence-based DPB1 typing identified two novel DPB1 alleles, DPB1*9401 and DPB1*9501, from a Kenyan population. Tissue Antigens. 2003 Aug;62(2):182-4. 12890000
  37. Witter K, Gervais T, Dunn PP, Voorter C, Muramoto J, Albert ED: Sequence-based typing identifies a novel HLA-DPB1 allele, DPB1*9601. Tissue Antigens. 2003 Aug;62(2):185-7. 12890001
  38. Lv F, Lin J, Liu Z, Gao J, Fu Y, Xu A: Identification of a novel HLA-DPB1 allele--DPB1*0102. Tissue Antigens. 2004 Oct;64(4):512-4. 15361132
  39. Li M, Nie J, Xu Y, Xu A, Yu X: Identification of a novel HLA-DPB1 allele, DPB1*1702. Tissue Antigens. 2006 Aug;68(2):187-8. 16866899
  40. Moonsamy PV, Aldrich CL, Petersdorf EW, Hill AV, Begovich AB: Seven new DPB1 alleles and their population distribution. Tissue Antigens. 1994 Apr;43(4):249-52. 8085260
  41. Noreen H, Steiner L, Davidson M, Johnson S, Segall M, Begovich AB: Six new DPB1 alleles identified in a study of 1,302 unrelated bone marrow donor-recipient pairs. Tissue Antigens. 1997 May;49(5):512-6. 9174146
  42. Steiner LL, Wu J, Noreen HJ, Moehlenkamp C, Cavalli A, Davidson M, Johnson S, Winden T, Segall M, Begovich AB, Williams TM: Four new DP alleles identified in a study of 500 unrelated bone marrow donor-recipient pairs. Tissue Antigens. 1999 Feb;53(2):201-6. 10090623
  43. Lapi S, Curcio M, Fornaciari S, Mariotti ML, Isola P, Bonci F, Pistello M, Scatena F: Identification of a novel HLA-DPB1 allele, DPB1*9701, by sequence-based typing. Tissue Antigens. 2004 Jun;63(6):606-8. 15140044
  44. Versluis LF, Verduyn W, Abdulkadir J, Tilanus MG, Giphart MJ: Novel HLA-DPB1 alleles detected in the Ethiopian population. Hum Immunol. 1995 Feb;42(2):181-3. 7744621
  45. Noble JA, Cavalli AS, Erlich HA: DPB1*5901a: a novel HLA-DPB1 allele from a Caucasian family with insulin-dependent diabetes mellitus. Tissue Antigens. 1996 Feb;47(2):159-62. 8851734
  46. Sheldon MH, Azzaro MP, Sayer D, Bunce M, Sortino G: Identification of a new allele in a Sicilian individual: HLA-DPB1*0302. Tissue Antigens. 2005 Jul;66(1):64-6. 15982263
  47. Meyer CG, Schnittger L, Begovich AB, Erlich HA, Horstmann RD: DPB1*WA4--an additional HLA class II allele identified in west Africa. Tissue Antigens. 1992 Aug;40(2):98-9. 1412421
  48. Mitsunaga S, Kuwata S, Tokunaga K, Uchikawa C, Takahashi K, Akaza T, Mitomi Y, Juji T: Family study on HLA-DPB1 polymorphism: linkage analysis with HLA-DR/DQ and two "new" alleles. Hum Immunol. 1992 Jul;34(3):203-11. 1358867
  49. Ogawa K, Itho H, Nakajyo S, Kobayashi K, Sekiguchi S, Koshizaka T, Taguchi M, Onishi H, Kobayashi S, Inoko H: A novel HLA-DPB1 allele, DPB1*3601 (DPB1*KT). Tissue Antigens. 1994 Aug;44(2):134-6. 7817379
  50. Steiner LL, Cavalli A, Zimmerman PA, Boatin BA, Titanji VP, Bradley JE, Lucius R, Nutman TB, Begovich AB: Three new DP alleles identified in sub-Saharan Africa: DPB1*7401, DPA1*02013, and DPA1*0302. Tissue Antigens. 1998 Jun;51(6):653-7. 9694359
  51. Mersch G, Mytilineos J, De Canck I, Deufel A, Mijs W, Scherer S, Jannes G, Opelz G, Rossau R: Characterization of a new DPB1 allele (DPB1*5701) isolated from a Caucasian individual. Tissue Antigens. 1995 Sep;46(3 ( Pt 1)):208-12. 8525482
  52. McTernan CL, Mijovic CH, Cockram CS, Barnett AH: The nucleotide sequence of two new DP alleles, DPA1*02015 and DPB1*8401, identified in a Chinese subject. Tissue Antigens. 2000 Jul;56(1):95-8. 10958363
  53. Roux-Dosseto M, Auffray C, Lillie JW, Boss JM, Cohen D, DeMars R, Mawas C, Seidman JG, Strominger JL: Genetic mapping of a human class II antigen beta-chain cDNA clone to the SB region of the HLA complex. Proc Natl Acad Sci U S A. 1983 Oct;80(19):6036-40. 6310612
  54. Cresswell P: Invariant chain structure and MHC class II function. Cell. 1996 Feb 23;84(4):505-7. 8598037
  55. Villadangos JA: Presentation of antigens by MHC class II molecules: getting the most out of them. Mol Immunol. 2001 Sep;38(5):329-46. 11684289
  56. Rocha N, Neefjes J: MHC class II molecules on the move for successful antigen presentation. EMBO J. 2008 Jan 9;27(1):1-5. Epub 2007 Nov 29. 18046453
  57. Menendez-Benito V, Neefjes J: Autophagy in MHC class II presentation: sampling from within. Immunity. 2007 Jan;26(1):1-3. 17241953
  58. Berger AC, Roche PA: MHC class II transport at a glance. J Cell Sci. 2009 Jan 1;122(Pt 1):1-4. doi: 10.1242/jcs.035089. 19092054
  59. Beswick EJ, Reyes VE: CD74 in antigen presentation, inflammation, and cancers of the gastrointestinal tract. World J Gastroenterol. 2009 Jun 21;15(23):2855-61. 19533806