NameTyrosine-protein kinase SYK
Synonyms
  • 2.7.10.2
  • p72-Syk
  • Spleen tyrosine kinase
Gene NameSYK
OrganismHuman
Amino acid sequence
>lcl|BSEQ0002614|Tyrosine-protein kinase SYK
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Number of residues635
Molecular Weight72065.76
Theoretical pI8.4
GO Classification
Functions
  • receptor signaling protein tyrosine kinase activity
  • integrin binding
  • protein tyrosine kinase activity
  • ATP binding
  • protein kinase activity
  • protein serine/threonine kinase activity
  • non-membrane spanning protein tyrosine kinase activity
Processes
  • platelet activation
  • positive regulation of alpha-beta T cell proliferation
  • regulation of arachidonic acid secretion
  • positive regulation of interleukin-3 biosynthetic process
  • organ morphogenesis
  • regulation of neutrophil degranulation
  • positive regulation of mast cell degranulation
  • cell proliferation
  • peptidyl-serine phosphorylation
  • regulation of platelet aggregation
  • receptor internalization
  • blood vessel morphogenesis
  • regulation of superoxide anion generation
  • protein phosphorylation
  • stimulatory C-type lectin receptor signaling pathway
  • regulation of tumor necrosis factor-mediated signaling pathway
  • lymph vessel development
  • transcription factor import into nucleus
  • cellular response to low-density lipoprotein particle stimulus
  • positive regulation of cytokine secretion
  • viral process
  • defense response to bacterium
  • cell differentiation
  • adaptive immune response
  • integrin-mediated signaling pathway
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • regulation of ERK1 and ERK2 cascade
  • neutrophil activation involved in immune response
  • beta selection
  • innate immune response
  • leukocyte cell-cell adhesion
  • neutrophil chemotaxis
  • cellular response to molecule of fungal origin
  • peptidyl-tyrosine autophosphorylation
  • B cell receptor signaling pathway
  • regulation of platelet activation
  • leukocyte activation involved in immune response
  • positive regulation of peptidyl-tyrosine phosphorylation
  • regulation of sequence-specific DNA binding transcription factor activity
  • transmembrane receptor protein tyrosine kinase signaling pathway
  • serotonin secretion by platelet
  • macrophage activation involved in immune response
  • activation of JUN kinase activity
  • positive regulation of type I interferon production
  • blood coagulation
  • angiogenesis
  • positive regulation of B cell differentiation
  • Fc-epsilon receptor signaling pathway
  • positive regulation of receptor internalization
  • regulation of phagocytosis
  • positive regulation of bone resorption
  • leukotriene biosynthetic process
  • positive regulation of alpha-beta T cell differentiation
  • positive regulation of cell adhesion mediated by integrin
  • positive regulation of calcium-mediated signaling
  • positive regulation of gamma-delta T cell differentiation
  • positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process
Components
  • cytosol
  • extrinsic component of cytoplasmic side of plasma membrane
  • B cell receptor complex
  • cytoplasm
  • early phagosome
  • protein complex
  • nucleus
  • plasma membrane
  • T cell receptor complex
General FunctionReceptor signaling protein tyrosine kinase activity
Specific FunctionNon-receptor tyrosine kinase which mediates signal transduction downstream of a variety of transmembrane receptors including classical immunoreceptors like the B-cell receptor (BCR). Regulates several biological processes including innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation and vascular development. Assembles into signaling complexes with activated receptors at the plasma membrane via interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. The association with the receptor can also be indirect and mediated by adapter proteins containing ITAM or partial hemITAM domains. The phosphorylation of the ITAM domains is generally mediated by SRC subfamily kinases upon engagement of the receptor. More rarely signal transduction via SYK could be ITAM-independent. Direct downstream effectors phosphorylated by SYK include VAV1, PLCG1, PI-3-kinase, LCP2 and BLNK. Initially identified as essential in B-cell receptor (BCR) signaling, it is necessary for the maturation of B-cells most probably at the pro-B to pre-B transition. Activated upon BCR engagement, it phosphorylates and activates BLNK an adapter linking the activated BCR to downstream signaling adapters and effectors. It also phosphorylates and activates PLCG1 and the PKC signaling pathway. It also phosphorylates BTK and regulates its activity in B-cell antigen receptor (BCR)-coupled signaling. In addition to its function downstream of BCR plays also a role in T-cell receptor signaling. Plays also a crucial role in the innate immune response to fungal, bacterial and viral pathogens. It is for instance activated by the membrane lectin CLEC7A. Upon stimulation by fungal proteins, CLEC7A together with SYK activates immune cells inducing the production of ROS. Also activates the inflammasome and NF-kappa-B-mediated transcription of chemokines and cytokines in presence of pathogens. Regulates neutrophil degranulation and phagocytosis through activation of the MAPK signaling cascade. Also mediates the activation of dendritic cells by cell necrosis stimuli. Also involved in mast cells activation. Also functions downstream of receptors mediating cell adhesion. Relays for instance, integrin-mediated neutrophils and macrophages activation and P-selectin receptor/SELPG-mediated recruitment of leukocytes to inflammatory loci. Plays also a role in non-immune processes. It is for instance involved in vascular development where it may regulate blood and lymphatic vascular separation. It is also required for osteoclast development and function. Functions in the activation of platelets by collagen, mediating PLCG2 phosphorylation and activation. May be coupled to the collagen receptor by the ITAM domain-containing FCER1G. Also activated by the membrane lectin CLEC1B that is required for activation of platelets by PDPN/podoplanin. Involved in platelet adhesion being activated by ITGB3 engaged by fibrinogen.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID496900
UniProtKB IDP43405
UniProtKB Entry NameKSYK_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010918|Tyrosine-protein kinase SYK (SYK)
ATGGCCAGCAGCGGCATGGCTGACAGCGCCAACCACCTGCCCTTCTTTTTCGGCAACATC
ACCCGGGAGGAGGCAGAAGATTACCTGGTCCAGGGGGGCATGAGTGATGGGCTTTATTTG
CTGCGCCAGAGCCGCAACTACCTGGGTGGCTTCGCCCTGTCCGTGGCCCACGGGAGGAAG
GCACACCACTACACCATCGAGCGGGAGCTGAATGGCACCTACGCCATCGCCGGTGGCAGG
ACCCATGCCAGCCCCGCCGACCTCTGCCACTACCACTCCCAGGAGTCTGATGGCCTGGTC
TGCCTCCTCAAGAAGCCCTTCAACCGGCCCCAAGGGGTGCAGCCCAAGACTGGGCCCTTT
GAGGATTTGAAGGAAAACCTCATCAGGGAATATGTGAAGCAGACATGGAACCTGCAGGGT
CAGGCTCTGGAGCAGGCCATCATCAGTCAGAAGCCTCAGCTGGAGAAGCTGATCGCTACC
ACAGCCCATGAAAAAATGCCTTGGTTCCATGGAAAAATCTCTCGGGAAGAATCTGAGCAA
ATTGTCCTGATAGGATCAAAGACAAATGGAAAGTTCCTGATCCGAGCCAGAGACAACAAC
GGCTCCTACGCCCTGTGCCTGCTGCACGAAGGGAAGGTGCTGCACTATCGCATCGACAAA
GACAAGACAGGGAAGCTCTCCATCCCCGAGGGAAAGAAGTTCGACACGCTCTGGCAGCTA
GTCGAGCATTATTCTTATAAAGCAGATGGTTTGTTAAGAGTTCTTACTGTCCCATGTCAA
AAAATCGGCACACAGGGAAATGTTAATTTTGGAGGCCGTCCACAACTTCCAGGTTCCCAT
CCTGCGTCCTCCCCTGCCCAAGGGAACCGGCAAGAGAGTACTGTGTCATTCAATCCGTAT
GAGCCAGAACTTGCACCCTGGGCTGCAGACAAAGGCCCCCAGAGAGAAGCCCTACCCATG
GACACAGAGGTGTACGAGAGCCCCTACGCGGACCCCGAGGAGATCAGGCCCAAGGAGGTT
TACCTGGACCGAAAGCTGCTGACGCTGGAAGACAAAGAACTGGGCTCTGGTAATTTTGGA
ACTGTGAAAAAGGGCTACTACCAAATGAAAAAAGTTGTGAAAACCGTGGCTGTGAAAATA
CTGAAAAACGAGGCCAATGACCCCGCTCTTAAAGATGAGTTATTAGCAGAAGCAAATGTC
ATGCAGCAGCTGGACAACCCGTACATCGTGCGGATGATCGGGATATGCGAGGCCGAGTCC
TGGATGCTGGTTATGGAGATGGCAGAACTTGGTCCCCTCAATAAGTATTTGCAGCAGAAC
AGACATGTCAAGGATAAGAACATCATAGAACTGGTTCATCAGGTTTCCATGGGCATGAAG
TACTTGGAGGAGAGCAATTTTGTGCACAGAGATCTGGCTGCAAGAAATGTGTTGCTAGTT
ACCCAACATTACGCCAAGATCAGTGATTTCGGACTTTCCAAAGCACTGCGTGCTGATGAA
AACTACTACAAGGCCCAGACCCATGGAAAGTGGCCTGTCAAGTGGTACGCTCCGGAATGC
ATCAACTACTACAAGTTCTCCAGCAAAAGCGATGTCTGGAGCTTTGGAGTGTTGATGTGG
GAAGCATTCTCCTATGGGCAGAAGCCATATCGAGGGATGAAAGGAAGTGAAGTCACCGCT
ATGTTAGAGAAAGGAGAGCGGATGGGGTGCCCTGCAGGGTGTCCAAGAGAGATGTACGAT
CTCATGAATCTGTGCTGGACATACGATGTGGAAAACAGGCCCGGATTCGCAGCAGTGGAA
CTGCGGCTGCGCAATTACTACTATGACGTGGTGAACTAA
GenBank Gene IDZ29630
GeneCard IDNot Available
GenAtlas IDSYK
HGNC IDHGNC:11491
Chromosome Location9
Locus9q22
References
  1. Yagi S, Suzuki K, Hasegawa A, Okumura K, Ra C: Cloning of the cDNA for the deleted syk kinase homologous to ZAP-70 from human basophilic leukemia cell line (KU812). Biochem Biophys Res Commun. 1994 Apr 15;200(1):28-34. 7513161
  2. Law CL, Sidorenko SP, Chandran KA, Draves KE, Chan AC, Weiss A, Edelhoff S, Disteche CM, Clark EA: Molecular cloning of human Syk. A B cell protein-tyrosine kinase associated with the surface immunoglobulin M-B cell receptor complex. J Biol Chem. 1994 Apr 22;269(16):12310-9. 8163536
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. 15164053
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Muller B, Cooper L, Terhorst C: Molecular cloning of the human homologue to the pig protein-tyrosine kinase syk. Immunogenetics. 1994;39(5):359-62. 8168854
  6. Miller CL, Burkhardt AL, Lee JH, Stealey B, Longnecker R, Bolen JB, Kieff E: Integral membrane protein 2 of Epstein-Barr virus regulates reactivation from latency through dominant negative effects on protein-tyrosine kinases. Immunity. 1995 Feb;2(2):155-66. 7895172
  7. Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A: Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product. Immunity. 1996 Dec;5(6):591-604. 8986718
  8. Law CL, Chandran KA, Sidorenko SP, Clark EA: Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk. Mol Cell Biol. 1996 Apr;16(4):1305-15. 8657103
  9. Deckert M, Elly C, Altman A, Liu YC: Coordinated regulation of the tyrosine phosphorylation of Cbl by Fyn and Syk tyrosine kinases. J Biol Chem. 1998 Apr 10;273(15):8867-74. 9535867
  10. Lupher ML Jr, Rao N, Lill NL, Andoniou CE, Miyake S, Clark EA, Druker B, Band H: Cbl-mediated negative regulation of the Syk tyrosine kinase. A critical role for Cbl phosphotyrosine-binding domain binding to Syk phosphotyrosine 323. J Biol Chem. 1998 Dec 25;273(52):35273-81. 9857068
  11. Brockdorff J, Williams S, Couture C, Mustelin T: Dephosphorylation of ZAP-70 and inhibition of T cell activation by activated SHP1. Eur J Immunol. 1999 Aug;29(8):2539-50. 10458769
  12. Tang J, Sawasdikosol S, Chang JH, Burakoff SJ: SLAP, a dimeric adapter protein, plays a functional role in T cell receptor signaling. Proc Natl Acad Sci U S A. 1999 Aug 17;96(17):9775-80. 10449770
  13. Xu MJ, Zhao R, Zhao ZJ: Molecular cloning and characterization of SPAP1, an inhibitory receptor. Biochem Biophys Res Commun. 2001 Jan 26;280(3):768-75. 11162587
  14. Chiu CW, Dalton M, Ishiai M, Kurosaki T, Chan AC: BLNK: molecular scaffolding through 'cis'-mediated organization of signaling proteins. EMBO J. 2002 Dec 2;21(23):6461-72. 12456653
  15. Urzainqui A, Serrador JM, Viedma F, Yanez-Mo M, Rodriguez A, Corbi AL, Alonso-Lebrero JL, Luque A, Deckert M, Vazquez J, Sanchez-Madrid F: ITAM-based interaction of ERM proteins with Syk mediates signaling by the leukocyte adhesion receptor PSGL-1. Immunity. 2002 Oct;17(4):401-12. 12387735
  16. Obergfell A, Eto K, Mocsai A, Buensuceso C, Moores SL, Brugge JS, Lowell CA, Shattil SJ: Coordinate interactions of Csk, Src, and Syk kinases with [alpha]IIb[beta]3 initiate integrin signaling to the cytoskeleton. J Cell Biol. 2002 Apr 15;157(2):265-75. Epub 2002 Apr 8. 11940607
  17. Shim EK, Moon CS, Lee GY, Ha YJ, Chae SK, Lee JR: Association of the Src homology 2 domain-containing leukocyte phosphoprotein of 76 kD (SLP-76) with the p85 subunit of phosphoinositide 3-kinase. FEBS Lett. 2004 Sep 24;575(1-3):35-40. 15388330
  18. Kulathu Y, Hobeika E, Turchinovich G, Reth M: The kinase Syk as an adaptor controlling sustained calcium signalling and B-cell development. EMBO J. 2008 May 7;27(9):1333-44. doi: 10.1038/emboj.2008.62. Epub 2008 Mar 27. 18369315
  19. Tsang E, Giannetti AM, Shaw D, Dinh M, Tse JK, Gandhi S, Ho H, Wang S, Papp E, Bradshaw JM: Molecular mechanism of the Syk activation switch. J Biol Chem. 2008 Nov 21;283(47):32650-9. doi: 10.1074/jbc.M806340200. Epub 2008 Sep 25. 18818202
  20. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. 18088087
  21. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  22. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  23. Hughes CE, Pollitt AY, Mori J, Eble JA, Tomlinson MG, Hartwig JH, O'Callaghan CA, Futterer K, Watson SP: CLEC-2 activates Syk through dimerization. Blood. 2010 Apr 8;115(14):2947-55. doi: 10.1182/blood-2009-08-237834. Epub 2010 Feb 12. 20154219
  24. Cholay M, Reverdy C, Benarous R, Colland F, Daviet L: Functional interaction between the ubiquitin-specific protease 25 and the SYK tyrosine kinase. Exp Cell Res. 2010 Feb 15;316(4):667-75. doi: 10.1016/j.yexcr.2009.10.023. Epub 2009 Nov 10. 19909739
  25. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  26. Bohnenberger H, Oellerich T, Engelke M, Hsiao HH, Urlaub H, Wienands J: Complex phosphorylation dynamics control the composition of the Syk interactome in B cells. Eur J Immunol. 2011 Jun;41(6):1550-62. doi: 10.1002/eji.201041326. Epub 2011 May 25. 21469132
  27. Moon KD, Zhang X, Zhou Q, Geahlen RL: The protein-tyrosine kinase Syk interacts with the C-terminal region of tensin2. Biochim Biophys Acta. 2012 Feb;1823(2):199-205. doi: 10.1016/j.bbamcr.2011.10.001. Epub 2011 Oct 12. 22019427
  28. Romero-Camarero I, Jiang X, Natkunam Y, Lu X, Vicente-Duenas C, Gonzalez-Herrero I, Flores T, Garcia JL, McNamara G, Kunder C, Zhao S, Segura V, Fontan L, Martinez-Climent JA, Garcia-Criado FJ, Theis JD, Dogan A, Campos-Sanchez E, Green MR, Alizadeh AA, Cobaleda C, Sanchez-Garcia I, Lossos IS: Germinal centre protein HGAL promotes lymphoid hyperplasia and amyloidosis via BCR-mediated Syk activation. Nat Commun. 2013;4:1338. doi: 10.1038/ncomms2334. 23299888
  29. Narula SS, Yuan RW, Adams SE, Green OM, Green J, Philips TB, Zydowsky LD, Botfield MC, Hatada M, Laird ER, et al.: Solution structure of the C-terminal SH2 domain of the human tyrosine kinase Syk complexed with a phosphotyrosine pentapeptide. Structure. 1995 Oct 15;3(10):1061-73. 8590001
  30. Futterer K, Wong J, Grucza RA, Chan AC, Waksman G: Structural basis for Syk tyrosine kinase ubiquity in signal transduction pathways revealed by the crystal structure of its regulatory SH2 domains bound to a dually phosphorylated ITAM peptide. J Mol Biol. 1998 Aug 21;281(3):523-37. 9698567