NameProteasome subunit beta type-5
Synonyms
  • 3.4.25.1
  • LMPX
  • Macropain epsilon chain
  • MB1
  • Multicatalytic endopeptidase complex epsilon chain
  • Proteasome chain 6
  • Proteasome epsilon chain
  • Proteasome subunit MB1
  • Proteasome subunit X
  • X
Gene NamePSMB5
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037858|Proteasome subunit beta type-5
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
Number of residues263
Molecular Weight28480.01
Theoretical pI8.68
GO Classification
Functions
  • endopeptidase activity
  • threonine-type endopeptidase activity
Processes
  • epidermal growth factor receptor signaling pathway
  • regulation of mRNA stability
  • mitotic cell cycle
  • innate immune response
  • regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
  • G1/S transition of mitotic cell cycle
  • Fc-epsilon receptor signaling pathway
  • tumor necrosis factor-mediated signaling pathway
  • T cell receptor signaling pathway
  • positive regulation of canonical Wnt signaling pathway
  • regulation of cellular amino acid metabolic process
  • viral process
  • activation of MAPKK activity
  • apoptotic process
  • programmed cell death
  • anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
  • fibroblast growth factor receptor signaling pathway
  • proteasomal ubiquitin-independent protein catabolic process
  • response to oxidative stress
  • antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
  • insulin receptor signaling pathway
  • small GTPase mediated signal transduction
  • cellular nitrogen compound metabolic process
  • antigen processing and presentation of peptide antigen via MHC class I
  • MAPK cascade
  • gene expression
  • DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
  • negative regulation of apoptotic process
  • regulation of apoptotic process
  • negative regulation of canonical Wnt signaling pathway
  • neurotrophin TRK receptor signaling pathway
  • small molecule metabolic process
  • negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
  • Ras protein signal transduction
  • NIK/NF-kappaB signaling
  • stimulatory C-type lectin receptor signaling pathway
  • positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
  • vascular endothelial growth factor receptor signaling pathway
  • proteasome-mediated ubiquitin-dependent protein catabolic process
  • antigen processing and presentation of exogenous peptide antigen via MHC class I
  • axon guidance
  • protein polyubiquitination
  • polyamine metabolic process
Components
  • cytoplasm
  • centrosome
  • proteasome core complex
  • nucleus
  • proteasome complex
  • cytosol
  • extracellular exosome
  • nucleoplasm
General FunctionThreonine-type endopeptidase activity
Specific FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib. May catalyze basal processing of intracellular antigens. Plays a role in the protection against oxidative damage through the Nrf2-ARE pathway (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID558526
UniProtKB IDP28074
UniProtKB Entry NamePSB5_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019273|Proteasome subunit beta type-5 (PSMB5)
ATGGCTGGGGGCGCAGCGGATTGCAGCTTCTGGGAACGGCTGTTGGCTCGGCAATGTCGA
ATCTATGAGCTTCGAAATAAGGAACGCATCTCTGTAGCAGCTGCCTCCAAACTGCTTGCC
AACATGGTGTATCAGTACAAAGGCATGGGGCTGTCCATGGGCACCATGATCTGTGGCTGG
GATAAGAGAGGCCCTGGCCTCTACTACGTGGACAGTGAAGGGAACCGGATTTCAGGGGCC
ACCTTCTCTGTAGGTTCTGGCTCTGTGTATGCATATGGGGTCATGGATCGGGGCTATTCC
TATGACCTGGAAGTGGAGCAGGCCTATGATCTGGCCCGTCGAGCCATCTACCAAGCCACC
TACAGAGATGCCTACTCAGGAGGTGCAGTCAACCTCTACCACGTGCGGGAGGATGGCTGG
ATCCGAGTCTCCAGTGACAATGTGGCTGATCTACATGAGAAGTATAGTGGCTCTACCCCC
TGA
GenBank Gene IDD29011
GeneCard IDNot Available
GenAtlas IDPSMB5
HGNC IDHGNC:9542
Chromosome Location14
Locus14q11.2
References
  1. Abdulla S, Beck S, Belich M, Jackson A, Nakamura T, Trowsdale J: Divergent intron arrangement in the MB1/LMP7 proteasome gene pair. Immunogenetics. 1996;44(4):254-8. 8753855
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  4. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. 12508121
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Akiyama K, Yokota K, Kagawa S, Shimbara N, Tamura T, Akioka H, Nothwang HG, Noda C, Tanaka K, Ichihara A: cDNA cloning and interferon gamma down-regulation of proteasomal subunits X and Y. Science. 1994 Aug 26;265(5176):1231-4. 8066462
  7. Belich MP, Glynne RJ, Senger G, Sheer D, Trowsdale J: Proteasome components with reciprocal expression to that of the MHC-encoded LMP proteins. Curr Biol. 1994 Sep 1;4(9):769-76. 7820546
  8. Lee LW, Moomaw CR, Orth K, McGuire MJ, DeMartino GN, Slaughter CA: Relationships among the subunits of the high molecular weight proteinase, macropain (proteasome). Biochim Biophys Acta. 1990 Feb 9;1037(2):178-85. 2306472
  9. Kristensen P, Johnsen AH, Uerkvitz W, Tanaka K, Hendil KB: Human proteasome subunits from 2-dimensional gels identified by partial sequencing. Biochem Biophys Res Commun. 1994 Dec 30;205(3):1785-9. 7811265
  10. Akiyama K, Kagawa S, Tamura T, Shimbara N, Takashina M, Kristensen P, Hendil KB, Tanaka K, Ichihara A: Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing. FEBS Lett. 1994 Apr 18;343(1):85-8. 8163024
  11. Kristensen P, Johnsen AH, Uerkvitz W, Tanaka K, Hendil KB: Human proteasome subunits from 2-dimensional gels identified by partial sequencing. Biochem Biophys Res Commun. 1995 Feb 27;207(3):1059. 7864893
  12. Gaczynska M, Goldberg AL, Tanaka K, Hendil KB, Rock KL: Proteasome subunits X and Y alter peptidase activities in opposite ways to the interferon-gamma-induced subunits LMP2 and LMP7. J Biol Chem. 1996 Jul 19;271(29):17275-80. 8663318
  13. Apcher GS, Heink S, Zantopf D, Kloetzel PM, Schmid HP, Mayer RJ, Kruger E: Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits. FEBS Lett. 2003 Oct 9;553(1-2):200-4. 14550573
  14. Begley GS, Horvath AR, Taylor JC, Higgins CF: Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome. Mol Immunol. 2005 Jan;42(1):137-41. 15488952
  15. Heink S, Ludwig D, Kloetzel PM, Kruger E: IFN-gamma-induced immune adaptation of the proteasome system is an accelerated and transient response. Proc Natl Acad Sci U S A. 2005 Jun 28;102(26):9241-6. Epub 2005 Jun 8. 15944226
  16. Wang X, Chen CF, Baker PR, Chen PL, Kaiser P, Huang L: Mass spectrometric characterization of the affinity-purified human 26S proteasome complex. Biochemistry. 2007 Mar 20;46(11):3553-65. Epub 2007 Feb 27. 17323924
  17. Deng S, Zhou H, Xiong R, Lu Y, Yan D, Xing T, Dong L, Tang E, Yang H: Over-expression of genes and proteins of ubiquitin specific peptidases (USPs) and proteasome subunits (PSs) in breast cancer tissue observed by the methods of RFDD-PCR and proteomics. Breast Cancer Res Treat. 2007 Jul;104(1):21-30. Epub 2006 Sep 27. 17004105
  18. Oerlemans R, Franke NE, Assaraf YG, Cloos J, van Zantwijk I, Berkers CR, Scheffer GL, Debipersad K, Vojtekova K, Lemos C, van der Heijden JW, Ylstra B, Peters GJ, Kaspers GL, Dijkmans BA, Scheper RJ, Jansen G: Molecular basis of bortezomib resistance: proteasome subunit beta5 (PSMB5) gene mutation and overexpression of PSMB5 protein. Blood. 2008 Sep 15;112(6):2489-99. doi: 10.1182/blood-2007-08-104950. Epub 2008 Jun 18. 18565852
  19. Lu S, Yang J, Song X, Gong S, Zhou H, Guo L, Song N, Bao X, Chen P, Wang J: Point mutation of the proteasome beta5 subunit gene is an important mechanism of bortezomib resistance in bortezomib-selected variants of Jurkat T cell lymphoblastic lymphoma/leukemia line. J Pharmacol Exp Ther. 2008 Aug;326(2):423-31. doi: 10.1124/jpet.108.138131. Epub 2008 May 23. 18502982
  20. Lu S, Yang J, Chen Z, Gong S, Zhou H, Xu X, Wang J: Different mutants of PSMB5 confer varying bortezomib resistance in T lymphoblastic lymphoma/leukemia cells derived from the Jurkat cell line. Exp Hematol. 2009 Jul;37(7):831-7. doi: 10.1016/j.exphem.2009.04.001. Epub 2009 May 6. 19426847
  21. Ramirez MC, Singletary K: Regulation of estrogen receptor alpha expression in human breast cancer cells by sulforaphane. J Nutr Biochem. 2009 Mar;20(3):195-201. doi: 10.1016/j.jnutbio.2008.02.002. Epub 2008 Jul 7. 18602823
  22. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569