NameCytochrome c oxidase subunit 8A, mitochondrial
Synonyms
  • COX8
  • COX8L
  • Cytochrome c oxidase polypeptide VIII-liver/heart
  • Cytochrome c oxidase subunit 8-2
Gene NameCOX8A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012781|Cytochrome c oxidase subunit 8A, mitochondrial
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE
Number of residues69
Molecular Weight7579.0
Theoretical pI10.83
GO Classification
Functions
  • cytochrome-c oxidase activity
Processes
  • small molecule metabolic process
  • transcription initiation from RNA polymerase II promoter
  • cellular metabolic process
  • respiratory electron transport chain
  • hydrogen ion transmembrane transport
  • positive regulation of defense response to virus by host
  • xenophagy
  • mitophagy in response to mitochondrial depolarization
  • mitochondrial electron transport, cytochrome c to oxygen
  • generation of precursor metabolites and energy
  • gene expression
Components
  • mitochondrial respiratory chain complex IV
  • mitochondrial inner membrane
  • integral component of membrane
General FunctionCytochrome-c oxidase activity
Specific FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane Regions37-60
GenBank Protein ID38614453
UniProtKB IDP10176
UniProtKB Entry NameCOX8A_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0012782|Cytochrome c oxidase subunit 8A, mitochondrial (COX8A)
ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCA
GTGCCGCGCGCCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTG
GCCGTTGGGCTTACCTCCTGCTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCA
CACCTGGAGACCTACAGGAGGCCAGAGTGA
GenBank Gene IDBC063025
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2294
Chromosome Location11
Locus11q12-q13
References
  1. Rizzuto R, Nakase H, Darras B, Francke U, Fabrizi GM, Mengel T, Walsh F, Kadenbach B, DiMauro S, Schon EA: A gene specifying subunit VIII of human cytochrome c oxidase is localized to chromosome 11 and is expressed in both muscle and non-muscle tissues. J Biol Chem. 1989 Jun 25;264(18):10595-600. 2543673
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Van Kuilenburg AB, Muijsers AO, Demol H, Dekker HL, Van Beeumen JJ: Human heart cytochrome c oxidase subunit VIII. Purification and determination of the complete amino acid sequence. FEBS Lett. 1988 Nov 21;240(1-2):127-32. 2847943