NameIg lambda-1 chain C regions
SynonymsNot Available
Gene NameIGLC1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009386|Ig lambda-1 chain C regions
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Number of residues106
Molecular Weight11347.585
Theoretical pINot Available
GO Classification
Functions
  • immunoglobulin receptor binding
  • antigen binding
Processes
  • complement activation
  • phagocytosis, recognition
  • positive regulation of B cell activation
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
  • Fc-epsilon receptor signaling pathway
  • receptor-mediated endocytosis
  • regulation of immune response
  • defense response to bacterium
  • phagocytosis, engulfment
  • B cell receptor signaling pathway
  • complement activation, classical pathway
  • immune response
Components
  • plasma membrane
  • immunoglobulin complex, circulating
  • extracellular space
  • extracellular exosome
  • external side of plasma membrane
  • blood microparticle
  • extracellular region
General FunctionImmunoglobulin receptor binding
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP0CG04
UniProtKB Entry NameLAC1_HUMAN
Cellular LocationNot Available
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:5855
Chromosome LocationNot Available
LocusNot Available
References
  1. Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. 4415202
  2. Vasicek TJ, Leder P: Structure and expression of the human immunoglobulin lambda genes. J Exp Med. 1990 Aug 1;172(2):609-20. 2115572
  3. Hieter PA, Hollis GF, Korsmeyer SJ, Waldmann TA, Leder P: Clustered arrangement of immunoglobulin lambda constant region genes in man. Nature. 1981 Dec 10;294(5841):536-40. 6273747
  4. Azkargorta M, Soria J, Ojeda C, Guzman F, Acera A, Iloro I, Suarez T, Elortza F: Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification. J Proteome Res. 2015 Jun 5;14(6):2649-58. doi: 10.1021/acs.jproteome.5b00179. Epub 2015 May 20. 25946035
  5. Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. 2515285