NameC-X-C motif chemokine 10
Synonyms
  • 10 kDa interferon gamma-induced protein
  • Gamma-IP10
  • INP10
  • IP-10
  • SCYB10
  • Small-inducible cytokine B10
Gene NameCXCL10
OrganismHuman
Amino acid sequence
>lcl|BSEQ0016256|C-X-C motif chemokine 10
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Number of residues98
Molecular Weight10880.915
Theoretical pI10.62
GO Classification
Functions
  • cAMP-dependent protein kinase regulator activity
  • CXCR3 chemokine receptor binding
  • receptor binding
  • chemokine activity
  • heparin binding
Processes
  • regulation of endothelial tube morphogenesis
  • response to cold
  • cell-cell signaling
  • regulation of T cell chemotaxis
  • response to vitamin D
  • chemotaxis
  • T cell chemotaxis
  • muscle organ development
  • positive regulation of T cell migration
  • regulation of protein kinase activity
  • regulation of cell proliferation
  • response to gamma radiation
  • chemokine-mediated signaling pathway
  • positive regulation of transcription from RNA polymerase II promoter
  • cellular response to heat
  • blood circulation
  • defense response to virus
  • G-protein coupled receptor signaling pathway
  • negative regulation of angiogenesis
  • cell surface receptor signaling pathway
  • signal transduction
  • positive regulation of cell proliferation
  • positive regulation of cAMP metabolic process
  • positive regulation of release of sequestered calcium ion into cytosol
  • positive regulation of leukocyte chemotaxis
  • cellular response to lipopolysaccharide
  • immune response
  • response to auditory stimulus
  • positive regulation of monocyte chemotaxis
  • endothelial cell activation
  • negative regulation of myoblast differentiation
  • positive regulation of cAMP-mediated signaling
  • inflammatory response
  • negative regulation of myoblast fusion
Components
  • external side of plasma membrane
  • extracellular region
  • extracellular space
General FunctionReceptor binding
Specific FunctionChemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID33918
UniProtKB IDP02778
UniProtKB Entry NameCXL10_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0016257|C-X-C motif chemokine 10 (CXCL10)
ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAA
GGAGTACCTCTCTCTAGAACTGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTT
AATCCAAGGTCTTTAGAAAAACTTGAAATTATTCCTGCAAGCCAATTTTGTCCACGTGTT
GAGATCATTGCTACAATGAAAAAGAAGGGTGAGAAGAGATGTCTGAATCCAGAATCGAAG
GCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGTCTAAAAGATCTCCTTAA
GenBank Gene IDX02530
GeneCard IDNot Available
GenAtlas IDCXCL10
HGNC IDHGNC:10637
Chromosome Location4
Locus4q21
References
  1. Luster AD, Unkeless JC, Ravetch JV: Gamma-interferon transcriptionally regulates an early-response gene containing homology to platelet proteins. Nature. 1985 Jun 20-26;315(6021):672-6. 3925348
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Proost P, De Wolf-Peeters C, Conings R, Opdenakker G, Billiau A, Van Damme J: Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8. J Immunol. 1993 Feb 1;150(3):1000-10. 8423327
  4. Tensen CP, Flier J, Van Der Raaij-Helmer EM, Sampat-Sardjoepersad S, Van Der Schors RC, Leurs R, Scheper RJ, Boorsma DM, Willemze R: Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3). J Invest Dermatol. 1999 May;112(5):716-22. 10233762
  5. Hensbergen PJ, van der Raaij-Helmer EM, Dijkman R, van der Schors RC, Werner-Felmayer G, Boorsma DM, Scheper RJ, Willemze R, Tensen CP: Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity. Eur J Biochem. 2001 Sep;268(18):4992-9. 11559369
  6. Loos T, Mortier A, Gouwy M, Ronsse I, Put W, Lenaerts JP, Van Damme J, Proost P: Citrullination of CXCL10 and CXCL11 by peptidylarginine deiminase: a naturally occurring posttranslational modification of chemokines and new dimension of immunoregulation. Blood. 2008 Oct 1;112(7):2648-56. doi: 10.1182/blood-2008-04-149039. Epub 2008 Jul 21. 18645041
  7. Booth V, Keizer DW, Kamphuis MB, Clark-Lewis I, Sykes BD: The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions. Biochemistry. 2002 Aug 20;41(33):10418-25. 12173928