NameTumor necrosis factor
Synonyms
  • Cachectin
  • TNF-a
  • TNF-alpha
  • TNFA
  • TNFSF2
  • Tumor necrosis factor ligand superfamily member 2
Gene NameTNF
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001404|Tumor necrosis factor
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Number of residues233
Molecular Weight25644.15
Theoretical pI6.92
GO Classification
Functions
  • cytokine activity
  • tumor necrosis factor receptor binding
  • protease binding
  • transcription regulatory region DNA binding
  • identical protein binding
Processes
  • response to virus
  • positive regulation of translational initiation by iron
  • positive regulation of protein complex disassembly
  • regulation of establishment of endothelial barrier
  • lipopolysaccharide-mediated signaling pathway
  • positive regulation of JUN kinase activity
  • positive regulation of chemokine (C-X-C motif) ligand 2 production
  • extracellular matrix organization
  • negative regulation of lipid catabolic process
  • protein import into nucleus, translocation
  • positive regulation of protein localization to cell surface
  • regulation of I-kappaB kinase/NF-kappaB signaling
  • positive regulation of ERK1 and ERK2 cascade
  • positive regulation of protein kinase activity
  • extrinsic apoptotic signaling pathway via death domain receptors
  • positive regulation of transcription, DNA-templated
  • death-inducing signaling complex assembly
  • positive regulation of fever generation
  • negative regulation of branching involved in lung morphogenesis
  • sequestering of triglyceride
  • positive regulation of smooth muscle cell proliferation
  • defense response to Gram-positive bacterium
  • negative regulation of osteoblast differentiation
  • MAPK cascade
  • negative regulation of transcription, DNA-templated
  • tumor necrosis factor-mediated signaling pathway
  • negative regulation of protein complex disassembly
  • positive regulation of hair follicle development
  • embryonic digestive tract development
  • negative regulation of interleukin-6 production
  • response to salt stress
  • positive regulation of peptidyl-serine phosphorylation
  • positive regulation of protein kinase B signaling
  • positive regulation of cell adhesion
  • regulation of branching involved in salivary gland morphogenesis
  • positive regulation of chronic inflammatory response to antigenic stimulus
  • negative regulation of viral genome replication
  • transformed cell apoptotic process
  • positive regulation of transcription from RNA polymerase II promoter
  • negative regulation of growth of symbiont in host
  • positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
  • positive regulation of humoral immune response mediated by circulating immunoglobulin
  • humoral immune response
  • positive regulation of interleukin-8 production
  • extrinsic apoptotic signaling pathway
  • negative regulation of lipid storage
  • negative regulation of fat cell differentiation
  • regulation of insulin secretion
  • positive regulation of interleukin-8 biosynthetic process
  • leukocyte tethering or rolling
  • positive regulation of cytokine production
  • inflammatory response
  • activation of MAPK activity
  • positive regulation of NIK/NF-kappaB signaling
  • positive regulation of calcidiol 1-monooxygenase activity
  • cell surface receptor signaling pathway
  • positive regulation of nitric oxide biosynthetic process
  • cortical actin cytoskeleton organization
  • JNK cascade
  • negative regulation of glucose import
  • positive regulation of chemokine biosynthetic process
  • positive regulation of interleukin-6 production
  • cellular response to organic cyclic compound
  • establishment of protein localization to plasma membrane
  • glucose metabolic process
  • positive regulation of chemokine production
  • necroptotic signaling pathway
  • positive regulation of membrane protein ectodomain proteolysis
  • positive regulation of vitamin D biosynthetic process
  • positive regulation of phagocytosis
  • positive regulation of I-kappaB kinase/NF-kappaB signaling
  • negative regulation of bicellular tight junction assembly
  • intrinsic apoptotic signaling pathway in response to DNA damage
  • positive regulation of gene expression
  • positive regulation of protein complex assembly
  • positive regulation of mononuclear cell migration
  • receptor biosynthetic process
  • cellular response to nicotine
  • negative regulation of myosin-light-chain-phosphatase activity
  • positive regulation of apoptotic process
  • negative regulation of gene expression
  • negative regulation of myoblast differentiation
  • response to glucocorticoid
  • epithelial cell proliferation involved in salivary gland morphogenesis
  • regulation of tumor necrosis factor-mediated signaling pathway
  • positive regulation of protein phosphorylation
  • positive regulation of interferon-gamma production
  • regulation of immunoglobulin secretion
  • positive regulation of sequence-specific DNA binding transcription factor activity
  • negative regulation of transcription from RNA polymerase II promoter
  • positive regulation of NF-kappaB transcription factor activity
  • positive regulation of cytokine secretion
  • I-kappaB kinase/NF-kappaB signaling
  • negative regulation of alkaline phosphatase activity
  • positive regulation of programmed cell death
  • protein kinase B signaling
  • negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
  • activation of MAPKKK activity
  • positive regulation of heterotypic cell-cell adhesion
  • negative regulation of cytokine secretion involved in immune response
  • chronic inflammatory response to antigenic stimulus
  • osteoclast differentiation
  • positive regulation of ceramide biosynthetic process
  • activation of cysteine-type endopeptidase activity involved in apoptotic process
  • positive regulation of NFAT protein import into nucleus
  • positive regulation of protein transport
  • positive regulation of NF-kappaB import into nucleus
  • positive regulation of MAP kinase activity
  • positive regulation of osteoclast differentiation
  • positive regulation of podosome assembly
  • cellular response to amino acid stimulus
Components
  • extracellular region
  • phagocytic cup
  • plasma membrane
  • extracellular space
  • cell surface
  • membrane raft
  • external side of plasma membrane
  • integral component of plasma membrane
  • recycling endosome
General FunctionTumor necrosis factor receptor binding
Specific FunctionCytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:22517918).The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Pfam Domain Function
Transmembrane Regions36-56
GenBank Protein ID339741
UniProtKB IDP01375
UniProtKB Entry NameTNFA_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021837|Tumor necrosis factor (TNF)
ATGAGCACTGAAAGCATGATCCGGGACGTGGAGCTGGCCGAGGAGGCGCTCCCCAAGAAG
ACAGGGGGGCCCCAGGGCTCCAGGCGGTGCTTGTTCCTCAGCCTCTTCTCCTTCCTGATC
GTGGCAGGCGCCACCACGCTCTTCTGCCTGCTGCACTTTGGAGTGATCGGCCCCCAGAGG
GAAGAGTTCCCCAGGGACCTCTCTCTAATCAGCCCTCTGGCCCAGGCAGTCAGATCATCT
TCTCGAACCCCGAGTGACAAGCCTGTAGCCCATGTTGTAGCAAACCCTCAAGCTGAGGGG
CAGCTCCAGTGGCTGAACCGCCGGGCCAATGCCCTCCTGGCCAATGGCGTGGAGCTGAGA
GATAACCAGCTGGTGGTGCCATCAGAGGGCCTGTACCTCATCTACTCCCAGGTCCTCTTC
AAGGGCCAAGGCTGCCCCTCCACCCATGTGCTCCTCACCCACACCATCAGCCGCATCGCC
GTCTCCTACCAGACCAAGGTCAACCTCCTCTCTGCCATCAAGAGCCCCTGCCAGAGGGAG
ACCCCAGAGGGGGCTGAGGCCAAGCCCTGGTATGAGCCCATCTATCTGGGAGGGGTCTTC
CAGCTGGAGAAGGGTGACCGACTCAGCGCTGAGATCAATCGGCCCGACTATCTCGACTTT
GCCGAGTCTGGGCAGGTCTACTTTGGGATCATTGCCCTGTGA
GenBank Gene IDM16441
GeneCard IDNot Available
GenAtlas IDTNF
HGNC IDHGNC:11892
Chromosome Location6
Locus6p21.3
References
  1. Nedospasov SA, Shakhov AN, Turetskaya RL, Mett VA, Azizov MM, Georgiev GP, Korobko VG, Dobrynin VN, Filippov SA, Bystrov NS, et al.: Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome. Cold Spring Harb Symp Quant Biol. 1986;51 Pt 1:611-24. 3555974
  2. Pennica D, Nedwin GE, Hayflick JS, Seeburg PH, Derynck R, Palladino MA, Kohr WJ, Aggarwal BB, Goeddel DV: Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin. Nature. 1984 Dec 20-1985 Jan 2;312(5996):724-9. 6392892
  3. Shirai T, Yamaguchi H, Ito H, Todd CW, Wallace RB: Cloning and expression in Escherichia coli of the gene for human tumour necrosis factor. Nature. 1985 Feb 28-Mar 6;313(6005):803-6. 3883195
  4. Nedwin GE, Naylor SL, Sakaguchi AY, Smith D, Jarrett-Nedwin J, Pennica D, Goeddel DV, Gray PW: Human lymphotoxin and tumor necrosis factor genes: structure, homology and chromosomal localization. Nucleic Acids Res. 1985 Sep 11;13(17):6361-73. 2995927
  5. Wang AM, Creasey AA, Ladner MB, Lin LS, Strickler J, Van Arsdell JN, Yamamoto R, Mark DF: Molecular cloning of the complementary DNA for human tumor necrosis factor. Science. 1985 Apr 12;228(4696):149-54. 3856324
  6. Marmenout A, Fransen L, Tavernier J, Van der Heyden J, Tizard R, Kawashima E, Shaw A, Johnson MJ, Semon D, Muller R, et al.: Molecular cloning and expression of human tumor necrosis factor and comparison with mouse tumor necrosis factor. Eur J Biochem. 1985 Nov 4;152(3):515-22. 3932069
  7. Iris FJ, Bougueleret L, Prieur S, Caterina D, Primas G, Perrot V, Jurka J, Rodriguez-Tome P, Claverie JM, Dausset J, et al.: Dense Alu clustering and a potential new member of the NF kappa B family within a 90 kilobase HLA class III segment. Nat Genet. 1993 Feb;3(2):137-45. 8499947
  8. Neville MJ, Campbell RD: A new member of the Ig superfamily and a V-ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC. J Immunol. 1999 Apr 15;162(8):4745-54. 10202016
  9. Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L: Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse. Genome Res. 2003 Dec;13(12):2621-36. 14656967
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  11. Takakura-Yamamoto R, Yamamoto S, Fukuda S, Kurimoto M: O-glycosylated species of natural human tumor-necrosis factor-alpha. Eur J Biochem. 1996 Jan 15;235(1-2):431-7. 8631363
  12. Pocsik E, Duda E, Wallach D: Phosphorylation of the 26 kDa TNF precursor in monocytic cells and in transfected HeLa cells. J Inflamm. 1995;45(3):152-60. 8597870
  13. Watts AD, Hunt NH, Wanigasekara Y, Bloomfield G, Wallach D, Roufogalis BD, Chaudhri G: A casein kinase I motif present in the cytoplasmic domain of members of the tumour necrosis factor ligand family is implicated in 'reverse signalling'. EMBO J. 1999 Apr 15;18(8):2119-26. 10205166
  14. Van Ostade X, Tavernier J, Prange T, Fiers W: Localization of the active site of human tumour necrosis factor (hTNF) by mutational analysis. EMBO J. 1991 Apr;10(4):827-36. 2009860
  15. Stevenson FT, Bursten SL, Locksley RM, Lovett DH: Myristyl acylation of the tumor necrosis factor alpha precursor on specific lysine residues. J Exp Med. 1992 Oct 1;176(4):1053-62. 1402651
  16. Moss ML, Jin SL, Milla ME, Bickett DM, Burkhart W, Carter HL, Chen WJ, Clay WC, Didsbury JR, Hassler D, Hoffman CR, Kost TA, Lambert MH, Leesnitzer MA, McCauley P, McGeehan G, Mitchell J, Moyer M, Pahel G, Rocque W, Overton LK, Schoenen F, Seaton T, Su JL, Becherer JD, et al.: Cloning of a disintegrin metalloproteinase that processes precursor tumour-necrosis factor-alpha. Nature. 1997 Feb 20;385(6618):733-6. 9034191
  17. Knight JC, Udalova I, Hill AV, Greenwood BM, Peshu N, Marsh K, Kwiatkowski D: A polymorphism that affects OCT-1 binding to the TNF promoter region is associated with severe malaria. Nat Genet. 1999 Jun;22(2):145-50. 10369255
  18. Friedmann E, Hauben E, Maylandt K, Schleeger S, Vreugde S, Lichtenthaler SF, Kuhn PH, Stauffer D, Rovelli G, Martoglio B: SPPL2a and SPPL2b promote intramembrane proteolysis of TNFalpha in activated dendritic cells to trigger IL-12 production. Nat Cell Biol. 2006 Aug;8(8):843-8. Epub 2006 Jul 9. 16829952
  19. Fluhrer R, Grammer G, Israel L, Condron MM, Haffner C, Friedmann E, Bohland C, Imhof A, Martoglio B, Teplow DB, Haass C: A gamma-secretase-like intramembrane cleavage of TNFalpha by the GxGD aspartyl protease SPPL2b. Nat Cell Biol. 2006 Aug;8(8):894-6. Epub 2006 Jul 9. 16829951
  20. Jinesh G G, Chunduru S, Kamat AM: Smac mimetic enables the anticancer action of BCG-stimulated neutrophils through TNF-alpha but not through TRAIL and FasL. J Leukoc Biol. 2012 Jul;92(1):233-44. doi: 10.1189/jlb.1211623. Epub 2012 Apr 18. 22517918
  21. Nie H, Zheng Y, Li R, Guo TB, He D, Fang L, Liu X, Xiao L, Chen X, Wan B, Chin YE, Zhang JZ: Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-alpha in rheumatoid arthritis. Nat Med. 2013 Mar;19(3):322-8. doi: 10.1038/nm.3085. Epub 2013 Feb 10. 23396208
  22. Jones EY, Stuart DI, Walker NP: Structure of tumour necrosis factor. Nature. 1989 Mar 16;338(6212):225-8. 2922050
  23. Jones EY, Stuart DI, Walker NP: The structure of tumour necrosis factor--implications for biological function. J Cell Sci Suppl. 1990;13:11-8. 1964681
  24. Eck MJ, Sprang SR: The structure of tumor necrosis factor-alpha at 2.6 A resolution. Implications for receptor binding. J Biol Chem. 1989 Oct 15;264(29):17595-605. 2551905
  25. Reed C, Fu ZQ, Wu J, Xue YN, Harrison RW, Chen MJ, Weber IT: Crystal structure of TNF-alpha mutant R31D with greater affinity for receptor R1 compared with R2. Protein Eng. 1997 Oct;10(10):1101-7. 9488135
  26. Cha SS, Kim JS, Cho HS, Shin NK, Jeong W, Shin HC, Kim YJ, Hahn JH, Oh BH: High resolution crystal structure of a human tumor necrosis factor-alpha mutant with low systemic toxicity. J Biol Chem. 1998 Jan 23;273(4):2153-60. 9442056
  27. Balding J, Kane D, Livingstone W, Mynett-Johnson L, Bresnihan B, Smith O, FitzGerald O: Cytokine gene polymorphisms: association with psoriatic arthritis susceptibility and severity. Arthritis Rheum. 2003 May;48(5):1408-13. 12746914
  28. Kim YJ, Lee HS, Yoon JH, Kim CY, Park MH, Kim LH, Park BL, Shin HD: Association of TNF-alpha promoter polymorphisms with the clearance of hepatitis B virus infection. Hum Mol Genet. 2003 Oct 1;12(19):2541-6. Epub 2003 Aug 5. 12915457