| Version |
1.0 |
| Creation Date |
2009-07-21 20:26:20 |
| Update Date |
2010-05-18 20:59:26 |
| Accession Number |
T3D2719 |
| Name |
Temazepam |
| Compound Type |
- Adjuvant, Anesthesia
- Anti-Anxiety Agent
- Benzodiazepine
- Drug
- GABA Modulator
- Hypnotic and Sedative
|
| Description |
A benzodiazepine that acts as a gamma-aminobutyric acid modulator and anti-anxiety agent. [PubChem] |
| Synonyms |
- Hydroxydiazepam
- Methyloxazepam
- N-Methyloxazepam
- Oxydiazepam
|
| Chemical IUPAC Name |
7-chloro-3-hydroxy-1-methyl-5-phenyl-2,3-dihydro-1H-1,4-benzodiazepin-2-one |
| Chemical Formula |
C16H13ClN2O2 |
| Chemical Structure |
 |
| CAS Registry Number |
846-50-4 |
| InChI Identifier |
InChI=1S/C16H13ClN2O2/c1-19-13-8-7-11(17)9-12(13)14(18-15(20)16(19)21)10-5-3-2-4-6-10/h2-9,15,20H,1H3 |
| InChI Key |
InChIKey=SEQDDYPDSLOBDC-UHFFFAOYSA-N |
| PubChem Compound ID |
5391  |
| KEGG ID |
Not Available |
| UniProt ID |
Not Available |
| OMIM ID |
Not Available |
| ChEBI ID |
Not Available |
| BioCyc ID |
Not Available |
| SuperToxic ID |
Not Available |
| CTD ID |
Not Available |
| Stitch ID |
Temazepam |
| DrugBank ID |
DB00231 |
| PDB ID |
Not Available |
| ACToR ID |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Temazepam |
| Monoisotopic Mass |
300.066555 |
| MOL File |
Show |
| PDB File |
Show |
| SDF File |
Show |
| SMILES |
CN1C2=CC=C(Cl)C=C2C(=NC(O)C1=O)C1=CC=CC=C1 |
| Appearance |
Not Available |
| Melting Point |
119-121oC |
| Solubility |
164 mg/L |
| Predicted LogP |
2.7873 |
| Route of Exposure |
Oral |
| Mechanism of Action |
Benzodiazepines bind nonspecifically to benzodiazepine receptors, which affects muscle relaxation, anticonvulsant activity, motor coordination, and memory. As benzodiazepine receptors are thought to be coupled to gamma-aminobutyric acid-A (GABAA) receptors, this enhances the effects of GABA by increasing GABA affinity for the GABA receptor. Binding of the inhibitory neurotransmitter GABA to the site opens the chloride channel, resulting in a hyperpolarized cell membrane that prevents further excitation of the cell. |
| Metabolism |
Hepatic. Temazepam is completely metabolized through conjugation prior to excretion. The major metabolite is the O-conjugate of temazepam (90%). |
| Toxicity Values |
LD50: 1963 mg/kg (oral, mice) (T343)
LD50: 1833 mg/kg (oral, rat) (T343)
LD50: >2400 mg/kg (oral, rabbit) (T343) |
| Lethal Dose |
Not Available |
| Carcinogenicity (IARC Classification) |
Not Available |
| Uses/Sources |
Officially indicated for severe insomnia and other severe or disabling sleep disorders. |
| Minimum Risk Level |
Not Available |
| Health Effects |
They cause slurred speech, disorientation and "drunken" behavior. They are physically and psychologically addictive. |
| Symptoms |
Not Available |
| Treatment |
If the patient is conscious, vomiting should be induced mechanically or with emetics. Gastric lavage should be employed utilizing concurrently a cuffed endotracheal tube if the patient is unconscious to prevent aspiration and pulmonary complications. Maintenance of adequate pulmonary ventilation is essential. The use of pressor agents intravenously may be necessary to combat hypotension. Fluids should be administered intravenously to encourage diuresis. (V650) |
| General References |
- T345 - Oelschlager H: [Chemical and pharmacologic aspects of benzodiazepines] Schweiz Rundsch Med Prax. 1989 Jul 4;78(27-28):766-72. [PubMed ]
- T346 - Vozeh S: [Pharmacokinetic of benzodiazepines in old age] Schweiz Med Wochenschr. 1981 Nov 21;111(47):1789-93. [PubMed ]
- T348 - Rooke KC: The use of flurazepam (dalmane) as a substitute for barbiturates and methaqualone/diphenhydramine (mandrax) in general practice. J Int Med Res. 1976;4(5):355-9. [PubMed ]
- T343 - Drugs.com
- T347 - Shats V, Kozacov S: [Falls in the geriatric department: responsibility of the care-giver and the hospital] Harefuah. 1995 Jun 1;128(11):690-3, 743. [PubMed ]
- T344 - Rickels K: The clinical use of hypnotics: indications for use and the need for a variety of hypnotics. Acta Psychiatr Scand Suppl. 1986;332:132-41. [PubMed ]
|
| Targets |
- Translocator protein
|
|
Target 1
[top]
|
| Target 1 ID |
1151 |
| Target 1 Name |
Translocator protein |
| Target 1 Mechanism of Action |
Benzodiazepines bind nonspecifically to benzodiazepine receptors, which affects muscle relaxation, anticonvulsant activity, motor coordination, and memory. As benzodiazepine receptors are thought to be coupled to gamma-aminobutyric acid-A (GABAA) receptors, this enhances the effects of GABA by increasing GABA affinity for the GABA receptor. Binding of the inhibitory neurotransmitter GABA to the site opens the chloride channel, resulting in a hyperpolarized cell membrane that prevents further excitation of the cell. |
| Target 1 Description |
Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells (By similarity) |
| Target 1 Synonyms |
- Peripheral-type benzodiazepine receptor; PBR; PKBS; Mitochondrial benzodiazepine receptor
|
| Target 1 Gene Name |
TSPO |
| Target 1 Protein Sequence |
>Translocator protein
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
|
| Target 1 Number of Residues |
169 |
| Target 1 Molecular Weight |
18778.7 |
| Target 1 Theoretical pI |
9.33 |
| Target 1 GO Classification |
|
Function
|
| Not Available |
|
Process
|
| Not Available |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 1 General Function |
Signal transduction mechanisms |
| Target 1 Pathways |
Not Available |
| Target 1 Reactions |
Not Available |
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
- 6-26
- 47-67
- 80-100
- 106-126
- 135-155
|
| Target 1 Essentiality |
Non Essential |
| Target 1 Domain Function |
PF03073:TspO_MBR |
| Target 1 GenBank ID Protein |
Not Available |
| Target 1 UniProtKB ID |
P30536 |
| Target 1 Cellular Location |
Mitochondrion membrane |
| Target 1 Gene Sequence |
>510 bp
CCCCTGAACAGCAGCTGCAGCAGCCATGGCCCCGCCCTGGGTGCCCGCCATGGGCTTCAC
GCTGGCGCCCAGCCTGGGGTGCTTCGTGGGCTCCCGCTTTGTCCACGGCGAGGGTCTCCG
CTGGTACGCCGGCCTGCAGAAGCCCTCGTGGCACCCGCCCCACTGGGTGCTGGGCCCTGT
CTGGGGCACGCTCTACTCAGCCATGGGGTACGGCTCCTACCTGGTCTGGAAAGAGCTGGG
AGGCTTCACAGAGAAGGCTGTGGTTCCCCTGGGCCTCTACACTGGGCAGCTGGCCCTGAA
CTGGGCATGGCCCCCCATCTTCTTTGGTGCCCGACAAATGGGCTGGGCCTTGGTGGATCT
CCTGCTGGTCAGTGGGGCGGCGGCNGCCACTACCGTGGCCTGGTACCAGGTGAGCCCGCT
GGCCGCCCGCCTGCTCTACCCCTACCTGGCCTGGCTGGCCTTCGCGACCACACTCAACTA
CTGCGTATGGCGGGACAACCATGGCTGGCA
|
| Target 1 GenBank Gene ID |
Not Available |
| Target 1 GeneCard ID |
TSPO |
| Target 1 GenAtlas ID |
TSPO |
| Target 1 HGNC ID |
HGNC:1158 |
| Target 1 Chromosome Location |
Chromosome:22 |
| Target 1 Locus |
22q13.31 |
| Target 1 SNPs |
SNPJam Report |
| Target 1 Toxin References |
- T349 - Dobbin M, Martyres RF, Clode D, Champion De Crespigny FE: Association of benzodiazepine injection with the prescription of temazepam capsules. Drug Alcohol Rev. 2003 Jun;22(2):153-7. [PubMed ]
- T350 - Mant A, Whicker SD, McManus P, Birkett DJ, Edmonds D, Dumbrell D: Benzodiazepine utilisation in Australia: report from a new pharmacoepidemiological database. Aust J Public Health. 1993 Dec;17(4):345-9. [PubMed ]
- T245 - Miller EI, Wylie FM, Oliver JS: Detection of benzodiazepines in hair using ELISA and LC-ESI-MS-MS. J Anal Toxicol. 2006 Sep;30(7):441-8. [PubMed ]
|
| Target 1 General References |
1847678; 7721091; 16189298; 15461802; 10591208; 15489334; 9915832; 16822554 |
